PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family NF-YC
Protein Properties Length: 293aa    MW: 32314.9 Da    PI: 4.7854
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38601.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC58.41.6e-186861898
       NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
                ++++P arikki++adedv +i+  +Pvl+sk+ elf+ +l  r++  + e   +t+    ++ +v+r ++fdfl ++v +
  KFK38601.1  6 DTRFPAARIKKIMQADEDVGKIALAVPVLVSKSLELFLQDLCDRTYEITLERGAKTVSSLHLKHCVERYNVFDFLREVVSK 86
                5789************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.7E-25372IPR009072Histone-fold
SuperFamilySSF471132.0E-19488IPR009072Histone-fold
PfamPF008082.7E-19871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIALA VPVLVSKSLE LFLQDLCDRT YEITLERGAK  60
TVSSLHLKHC VERYNVFDFL REVVSKVPDY GQAQGQGQGQ GPGDVTMDDR TVSKRRKPIK  120
DEGNDSSDEE YKKSKTQEMG NSKPGGRGGR GRGRGRGRGG RAARAAEREN LNREIELETA  180
MVEPPPPQDS INIHASVSSP QEDDKKNVDG GIAASNEDTK QHLQGPKEGI DFDLNAESLD  240
LNETKLAPAI TADAASEEYP GWPMMELGKM DTAQLVSLGK RIDEDDEDYD EEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A6e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149158RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407330.11e-156hypothetical protein EUTSA_v10021246mg
TrEMBLA0A087H8Z90.0A0A087H8Z9_ARAAL; Uncharacterized protein
STRINGBra038724.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35062458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.11e-129nuclear factor Y, subunit C11